PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G0511
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 314aa    MW: 34020.3 Da    PI: 7.5016
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G0511genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.63.4e-191661147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ll ++v+++G+++W+++++ ++ gR++k+c++rw + 
      Gh_D11G0511 16 KGPWSPEEDDLLQKLVQKYGPRNWSLVSKSIP-GRSGKSCRLRWCNQ 61
                     79******************************.***********985 PP

2Myb_DNA-binding57.33.6e-1870112347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEde +++a++++G++ W+tIar ++ gRt++ +k++w++ 
      Gh_D11G0511  70 AFTPEEDETIIRAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 112
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.7721166IPR017930Myb domain
SuperFamilySSF466894.12E-3213109IPR009057Homeodomain-like
SMARTSM007172.5E-171564IPR001005SANT/Myb domain
PfamPF002493.2E-191661IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-261769IPR009057Homeodomain-like
CDDcd001672.23E-161860No hitNo description
SMARTSM007173.8E-1567115IPR001005SANT/Myb domain
PROSITE profilePS5129421.46768117IPR017930Myb domain
CDDcd001671.58E-1270113No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2370116IPR009057Homeodomain-like
PfamPF002491.2E-1570112IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MAVTSTSNKK EMDRIKGPWS PEEDDLLQKL VQKYGPRNWS LVSKSIPGRS GKSCRLRWCN  60
QLSPQVEHRA FTPEEDETII RAHARFGNKW ATIARLLNGR TDNAIKNHWN STLKRKCLSV  120
GEESYFITHG GYDGNLGGEG EQQPLKRSVS AGLYMSPGSP SGSDLSDSSV PVLSSSHVYK  180
PIPRTGGVNV DVNVMPLPGA EAAASSSNDP PTSLSLSLPG AESYELSVST LPVTESTQTR  240
NEAKNDGKGG GVMGFSAEFM AVMQEMIRME VRDYMVQMQQ QNGGVSGGEG MGMCLDAGFR  300
NVLSMSRVGV NKID
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-42151173105MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-42151173105C-Myb DNA-Binding Domain
1msf_C4e-42151173105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.92090.0boll| ovule| stem
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591222e-68AJ459122.1 Gossypium hirsutum partial myb104b gene, clone pGhMYB104b.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012489200.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW11e-102MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D2T9E30.0A0A0D2T9E3_G
STRINGPOPTR_0007s10490.11e-127(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-92myb domain protein 73